Structure of PDB 5xod Chain A Binding Site BS01

Receptor Information
>5xod Chain A (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSE
RFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQS
PNCNQRPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCT
IRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQM
Ligand information
>5xod Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGLQKTLEQFHLSSMSSLGGPA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xod Hydrophobic patches on SMAD2 and SMAD3 determine selective binding to cofactors
Resolution1.851 Å
Binding residue
(original residue number in PDB)		Y268 E270 Y340 G342 G343 N387 F390 A391 L394 A395 Q447 W448 K451 V452 Q455
Binding residue
(residue number reindexed from 1)		Y9 E11 Y81 G83 G84 N124 F127 A128 L131 A132 Q184 W185 K188 V189 Q192
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5xod, PDBe:5xod, PDBj:5xod
PDBsum5xod
PubMed29588413
UniProtQ15796|SMAD2_HUMAN Mothers against decapentaplegic homolog 2 (Gene Name=SMAD2)

[Back to BioLiP]