Structure of PDB 5xnv Chain A Binding Site BS01

Receptor Information
>5xnv Chain A (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHF
VKKVWFFLHPSYKPNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKR
IDIIHNLKLDRTYTGLQTLGAETVVDVELHRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xnv YEATS2 links histone acetylation to tumorigenesis of non-small cell lung cancer.
Resolution2.696 Å
Binding residue
(original residue number in PDB)		H259 S261 Y262 G281 W282 G283 E284 R311
Binding residue
(residue number reindexed from 1)		H59 S61 Y62 G81 W82 G83 E84 R111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5xnv, PDBe:5xnv, PDBj:5xnv
PDBsum5xnv
PubMed29057918
UniProtQ9ULM3|YETS2_HUMAN YEATS domain-containing protein 2 (Gene Name=YEATS2)

[Back to BioLiP]