Structure of PDB 5xmm Chain A Binding Site BS01

Receptor Information
>5xmm Chain A (length=275) Species: 9685 (Felis catus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYFYTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDAPNPRMEPRAP
WVEQEGPEYWDRETRKVKNTAQIFRVDLNTLLRYYNQSESGSHNIQRMYG
CDVEPDGRLLRGYNQDSYDGKDYIALNEDLRSWTAADTAAQITGRKWEEA
GEAERWRNYLQGTCVESLAKYLDMGKETLLRAESPNTRVTRHPISDREVT
LRCWALGFYPAEITLTWQRDGQDHTQDAELVETRPAGDGTFQKWAAVVVS
SGEEQRYTCHVQHEGLREPITLRWE
Ligand information
>5xmm Chain C (length=9) Species: 11674 (Feline immunodeficiency virus (isolate Petaluma)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DMANVSTGR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xmm Major Histocompatibility Complex Class I (FLA-E*01801) Molecular Structure in Domestic Cats Demonstrates Species-Specific Characteristics in Presenting Viral Antigen Peptides
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y8 M46 R63 E64 K67 V68 N70 I74 D78 L82 Y85 I96 R98 Y100 D117 S118 Y124 T144 K147 W148 E153 W157 Y160 S168 Y172
Binding residue
(residue number reindexed from 1)		Y7 M45 R62 E63 K66 V67 N69 I73 D77 L81 Y84 I95 R97 Y99 D116 S117 Y123 T143 K146 W147 E152 W156 Y159 S167 Y171
Enzymatic activity
Enzyme Commision number ?
External links