Structure of PDB 5xhz Chain A Binding Site BS01

Receptor Information
>5xhz Chain A (length=60) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMF
PSNFIKELSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xhz Biochemical and Structural Studies of the Interaction between ARAP1 and CIN85.
Resolution1.319 Å
Binding residue
(original residue number in PDB)		F117 S118 D125 E126 V141 E142 E143 W145 E147 F161
Binding residue
(residue number reindexed from 1)		F10 S11 D18 E19 V34 E35 E36 W38 E40 F54
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5xhz, PDBe:5xhz, PDBj:5xhz
PDBsum5xhz
PubMed29589748
UniProtQ8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 (Gene Name=Sh3kbp1)

[Back to BioLiP]