Structure of PDB 5xcq Chain A Binding Site BS01

Receptor Information
>5xcq Chain A (length=166) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPEVQKPGETVRISCKASGYTFTTAGMQWVQKMPGKSLKWIGW
INTRSGVPKYAEDFKGRFAFSLETSASIAYLHINNLKNEDTATYFCAREG
PGFVYWGQGTLVTVSSGSDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIR
QKCQSKRQPILDAIEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xcq Fv-clasp: An Artificially Designed Small Antibody Fragment with Improved Production Compatibility, Stability, and Crystallizability
Resolution1.313 Å
Binding residue
(original residue number in PDB)
T30 A32 G33 W50 N52 T52A R53 E95 G96 P97
Binding residue
(residue number reindexed from 1)
T30 A32 G33 W50 N52 T53 R54 E99 G100 P101
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Feb 18 07:15:51 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5xcq', asym_id = 'A', bs = 'BS01', title = 'Fv-clasp: An Artificially Designed Small Antibod...n Compatibility, Stability, and Crystallizability'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5xcq', asym_id='A', bs='BS01', title='Fv-clasp: An Artificially Designed Small Antibod...n Compatibility, Stability, and Crystallizability')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004674,0007165,0051262', uniprot = '', pdbid = '5xcq', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004674,0007165,0051262', uniprot='', pdbid='5xcq', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>