Structure of PDB 5xa5 Chain A Binding Site BS01

Receptor Information
>5xa5 Chain A (length=248) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IDEVRSKNVLKQITQLINEVTNITETFPLKPGQTTEGLVATLDAAVANFL
QTGSFAISKCPIANSDPRAIDLLHEALGAVQDTGQVMIQTGRDFVRDSTS
TNKRAIATNSGRNLLTAVAKFLILADSIDVKVIVDKVDEVRETAHQMIEA
DTKIKVDDLYNLLISQIEELDITVRRRAIDLVKPNQRDDLLAARSALRQT
APLLYTSTRTFVRHPEHEEARRNRDYTADEMHSALNALESVLNGQQPK
Ligand information
>5xa5 Chain B (length=27) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TSIVEMMQMPTQQLKQSVMDLLTYEGS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xa5 Cell-cell adhesion in metazoans relies on evolutionarily conserved features of the alpha-catenin· beta-catenin-binding interface.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		N20 Q27 L28 E31 V32 I35 T38 F39 P40 T47 L54 A57 V58 F61 T64 G65 A68 F106 S110 R116 A119 T120 D138 D141
Binding residue
(residue number reindexed from 1)		N8 Q15 L16 E19 V20 I23 T26 F27 P28 T35 L42 A45 V46 F49 T52 G53 A56 F94 S98 R104 A107 T108 D126 D129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5xa5, PDBe:5xa5, PDBj:5xa5
PDBsum5xa5
PubMed28842483
UniProtP90947|HMP1_CAEEL Alpha-catenin-like protein hmp-1 (Gene Name=hmp-1)

[Back to BioLiP]