Structure of PDB 5x6m Chain A Binding Site BS01

Receptor Information
>5x6m Chain A (length=122) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQ
PSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICE
FPFGSKQKEVCINPYHYKRVES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5x6m Structural basis for the Smad5 MH1 domain to recognize different DNA sequences.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
S71 L72 L76 Q77 S79 K82
Binding residue
(residue number reindexed from 1)
S60 L61 L65 Q66 S68 K71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5x6m, PDBe:5x6m, PDBj:5x6m
PDBsum5x6m
PubMed26304548
UniProtP97454|SMAD5_MOUSE Mothers against decapentaplegic homolog 5 (Gene Name=Smad5)

[Back to BioLiP]