Structure of PDB 5x6g Chain A Binding Site BS01

Receptor Information
>5x6g Chain A (length=122) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPG
QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDIC
EFPFGSKQKEVCINPYHYKRVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5x6g Structural basis for the Smad5 MH1 domain to recognize different DNA sequences.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		S71 L72 Q77 K82
Binding residue
(residue number reindexed from 1)		S61 L62 Q67 K72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5x6g, PDBe:5x6g, PDBj:5x6g
PDBsum5x6g
PubMed26304548
UniProtP97454|SMAD5_MOUSE Mothers against decapentaplegic homolog 5 (Gene Name=Smad5)

[Back to BioLiP]