Structure of PDB 5x6d Chain A Binding Site BS01

Receptor Information

>5x6d Chain A (length=236) Species: 1639 (Listeria monocytogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSI
SENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINE
LKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILT
YVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVY
KNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN

Ligand information

>5x6d Chain C (length=29) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggtaggcattaacatttgttaacgacgat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5x6d Structural insights into glutathione-mediated activation of the master regulator PrfA in Listeria monocytogenes
Resolution	2.94 Å
Binding residue (original residue number in PDB)	K139 L140 I180 H182 S184 R188
Binding residue (residue number reindexed from 1)	K138 L139 I179 H181 S183 R187

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5x6d, PDBe:5x6d, PDBj:5x6d
PDBsum	5x6d
PubMed	28271443
UniProt	P22262\|PRFA_LISMO Listeriolysin regulatory protein (Gene Name=prfA)

[Back to BioLiP]