Structure of PDB 5x3z Chain A Binding Site BS01

Receptor Information
>5x3z Chain A (length=96) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGF
VTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5x3z Structural Insight into the Recognition of r(UAG) by Musashi-1 RBD2, and Construction of a Model of Musashi-1 RBD1-2 Bound to the Minimum Target RNA
ResolutionN/A
Binding residue
(original residue number in PDB)		K110 F112 G114 G115 M141 T146 H149 R150 F152 F154 E180 K182 K183 Q185 K187 M190 S195 R197 R199
Binding residue
(residue number reindexed from 1)		K6 F8 G10 G11 M37 T42 H45 R46 F48 F50 E76 K78 K79 Q81 K83 M86 S91 R93 R95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5x3z, PDBe:5x3z, PDBj:5x3z
PDBsum5x3z
PubMed28753936
UniProtQ61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 (Gene Name=Msi1)

[Back to BioLiP]