Structure of PDB 5wxg Chain A Binding Site BS01

Receptor Information
>5wxg Chain A (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPP
EEMQWFCPKCANK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wxg Kinetic and high-throughput profiling of epigenetic interactions by 3D-carbene chip-based surface plasmon resonance imaging technology
Resolution1.703 Å
Binding residue
(original residue number in PDB)		D877 G879 S880 P881 M882 I883 G884 C885 D886 D889 W891 W894 E905 M907
Binding residue
(residue number reindexed from 1)		D23 G25 S26 P27 M28 I29 G30 C31 D32 D35 W37 W40 E51 M53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5wxg, PDBe:5wxg, PDBj:5wxg
PDBsum5wxg
PubMed28808021
UniProtQ5VWG9|TAF3_HUMAN Transcription initiation factor TFIID subunit 3 (Gene Name=TAF3)

[Back to BioLiP]