Structure of PDB 5wwx Chain A Binding Site BS01

Receptor Information
>5wwx Chain A (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHHHMSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVT
PSRDKEPVFEVTGMPENVDRAREEIEMHIAMRTG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wwx The human RNA-binding protein and E3 ligase MEX-3C binds the MEX-3-recognition element (MRE) motif with high affinity
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H316 V338 G339 L340 V342 G343 K345 G346 I349 K350 Q353 I360 V361 T362 P363 R365
Binding residue
(residue number reindexed from 1)		H4 V26 G27 L28 V30 G31 K33 G34 I37 K38 Q41 I48 V49 T50 P51 R53
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5wwx, PDBe:5wwx, PDBj:5wwx
PDBsum5wwx
PubMed28808060
UniProtQ5U5Q3|MEX3C_HUMAN RNA-binding E3 ubiquitin-protein ligase MEX3C (Gene Name=MEX3C)

[Back to BioLiP]