Structure of PDB 5www Chain A Binding Site BS01

Receptor Information
>5www Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHHHHHHMQAALLRRKSVNTTECVPVPSSEHVAEIVGRQGCKIKALRAKT
NTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5www The human RNA-binding protein and E3 ligase MEX-3C binds the MEX-3-recognition element (MRE) motif with high affinity
Resolution1.798 Å
Binding residue
(original residue number in PDB)		S241 E242 V244 A245 E246 G249 R250 Q251 G252 K254 I255 K256 R259 I266 K267 T268 P269 R271 H299 F300 I303 R304
Binding residue
(residue number reindexed from 1)		S29 E30 V32 A33 E34 G37 R38 Q39 G40 K42 I43 K44 R47 I54 K55 T56 P57 R59 H87 F88 I91 R92
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5www, PDBe:5www, PDBj:5www
PDBsum5www
PubMed28808060
UniProtQ5U5Q3|MEX3C_HUMAN RNA-binding E3 ubiquitin-protein ligase MEX3C (Gene Name=MEX3C)

[Back to BioLiP]