Structure of PDB 5wwf Chain A Binding Site BS01

Receptor Information
>5wwf Chain A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFG
FVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLF
VGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDP
VDKIVLQKYHTINGHNAEVRKALSRQEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wwf Molecular basis for the specific and multivariant recognitions of RNA substrates by human hnRNP A2/B1.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		E18 K22 F24 D49 V51 M53 F64 F66 K94 A96 V97 R99 H108
Binding residue
(residue number reindexed from 1)		E3 K7 F9 D34 V36 M38 F49 F51 K79 A81 V82 R84 H93
Binding affinityPDBbind-CN: Kd=238.1nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5wwf, PDBe:5wwf, PDBj:5wwf
PDBsum5wwf
PubMed29379020
UniProtP22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (Gene Name=HNRNPA2B1)

[Back to BioLiP]