Structure of PDB 5wwe Chain A Binding Site BS01

Receptor Information
>5wwe Chain A (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGF
GFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKL
FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRKKRGFGFVTFDDHDPVD
KIVLQKYHTINGHNAEVRKALSRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wwe Molecular basis for the specific and multivariant recognitions of RNA substrates by human hnRNP A2/B1.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		E18 Q19 K22 F24 D49 V51 M53 R62 F64 F66 A96 V97 R99 S102 H108
Binding residue
(residue number reindexed from 1)		E4 Q5 K8 F10 D35 V37 M39 R48 F50 F52 A82 V83 R85 S88 H94
Binding affinityPDBbind-CN: Kd=534.8nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5wwe, PDBe:5wwe, PDBj:5wwe
PDBsum5wwe
PubMed29379020
UniProtP22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (Gene Name=HNRNPA2B1)

[Back to BioLiP]