Structure of PDB 5wvy Chain A Binding Site BS01

Receptor Information
>5wvy Chain A (length=59) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSGKKPVKVKTPAGKEAELVPEKVWAVAPKGRKGVKIGLFKDPETGKYFR
HKLPDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wvy Roles of Leu28 side chain intercalation in the interaction between Cren7 and DNA
Resolution2.0 Å
Binding residue
(original residue number in PDB)		W26 A27 V28 A29 P30 K31 Y49 R51
Binding residue
(residue number reindexed from 1)		W25 A26 V27 A28 P29 K30 Y48 R50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5wvy, PDBe:5wvy, PDBj:5wvy
PDBsum5wvy
PubMed28377493
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]