Structure of PDB 5wtt Chain A Binding Site BS01

Receptor Information
>5wtt Chain A (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVQLQESGPDLVKPSQSPSLTCTVTGYSITSDYSWHWIRQFPGDKLEWMG
YIHYSGSTNYNPSLKSRISITRDTSKNQFFLQLSSVTIEDTATYYCARGT
IYEGSLDYWGQGTTLTVSSAKTTPPSVYPLAPGNSMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH
PASSTKVDKKIVPRDC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wtt Molecular basis for the recognition of CCN1 by monoclonal antibody 093G9.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
S34 H36 W48 Y51 N59 T100 I101 G104 S105
Binding residue
(residue number reindexed from 1)
S34 H36 W48 Y51 N59 T100 I101 G104 S105
External links