Structure of PDB 5wt1 Chain A Binding Site BS01

Receptor Information
>5wt1 Chain A (length=332) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSGVKVRREDAKKVLELLKSVGILDGKRKAIRDEKYVIFPVTDTNIAKSL
GLEVVDVELPMRPERQIYKNLEDLLPREIFKKLGRLDIVGDIAIVSIPDE
ILSEREVIVSAIRKLYPKVKVIARRGFHSGLYRIRELEVIWGENRLHTIH
KENGVLIKVDLSKVFFNPRMKGERYRIAQLVNDGERILVPFAGVIPYPLV
IARFKNVEVYAVEINEFAVKLAEENLELNRDRLKGKIKIIHGDVFEVLPN
LPNFDRVVSPTPKGVDALSLTLSKAEKFLHYYDFVHESEIERFRERVLEE
CRRQGKECRVSVRKVSDYKPHVYKVCADVEIL
Ligand information
>5wt1 Chain C (length=67) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgguagcucagccugggagagcaccggacugaagauccgggugucgggg
guucaaaucccccccgc
<<<<..<<<<.........>>>><<<<<<.......>>>>>.>...<<<<
<.......>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wt1 Structural insight into the methyltransfer mechanism of the bifunctional Trm5.
Resolution2.598 Å
Binding residue
(original residue number in PDB)
R8 A11 K12 K19 G26 R32 V37 F39 R62 R65 Q66 I67 Y68 K69 R85 L86 Y116 K118 R125 F127 H128 R133 R135 K151 N153 G154 F165 R169 K171 F284 D317 Y318 K319 P320 H321 K324
Binding residue
(residue number reindexed from 1)
R8 A11 K12 K19 G26 R32 V37 F39 R62 R65 Q66 I67 Y68 K69 R85 L86 Y116 K118 R125 F127 H128 R133 R135 K151 N153 G154 F165 R169 K171 F284 D317 Y318 K319 P320 H321 K324
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
Gene Ontology
Molecular Function
GO:0008168 methyltransferase activity
GO:0008175 tRNA methyltransferase activity
GO:0016740 transferase activity
GO:0052906 tRNA (guanine(37)-N1)-methyltransferase activity
Biological Process
GO:0002939 tRNA N1-guanine methylation
GO:0008033 tRNA processing
GO:0030488 tRNA methylation
GO:0032259 methylation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5wt1, PDBe:5wt1, PDBj:5wt1
PDBsum5wt1
PubMed29214216
UniProtQ9V2G1|TAW22_PYRAB tRNA (guanine(37)-N1)/4-demethylwyosine(37)-methyltransferase Taw22 (Gene Name=taw22)

[Back to BioLiP]