Structure of PDB 5wrd Chain A Binding Site BS01

Receptor Information
>5wrd Chain A (length=117) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFL
VPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESER
DEDGFLYMVYASQETFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wrd The crystal structure of mouse LC3B in complex with the FYCO1 LIR reveals the importance of the flanking region of the LIR motif
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R10 R11 I23 K49 T50 K51 F52 L53 P55 V58 I66 R69 R70
Binding residue
(residue number reindexed from 1)		R7 R8 I20 K46 T47 K48 F49 L50 P52 V55 I63 R66 R67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000423 mitophagy
GO:0006914 autophagy
GO:0009267 cellular response to starvation
GO:0051649 establishment of localization in cell
GO:0070254 mucus secretion
GO:0070257 positive regulation of mucus secretion
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005776 autophagosome
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005930 axoneme
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0031966 mitochondrial membrane
GO:0044754 autolysosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wrd, PDBe:5wrd, PDBj:5wrd
PDBsum5wrd
PubMed28291748
UniProtQ9CQV6|MLP3B_MOUSE Microtubule-associated proteins 1A/1B light chain 3B (Gene Name=Map1lc3b)

[Back to BioLiP]