Structure of PDB 5wpl Chain A Binding Site BS01

Receptor Information
>5wpl Chain A (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC
LLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIK
RVKDSDDVPMVLVGNKCDLPSRTVESRQAQDLARSYGIPYIETSAKTRQG
VEDAFYTLVREIRKH
Ligand information
>5wpl Chain B (length=29) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPRCPGDDASIEDLHEYWARLWNYLYAVA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wpl Exceptionally high-affinity Ras binders that remodel its effector domain.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		E3 K5 E37 D38 S39 Y40 R41 D54 I55 L56 D57 T58 E63 R68 Y71
Binding residue
(residue number reindexed from 1)		E2 K4 E36 D37 S38 Y39 R40 D53 I54 L55 D56 T57 E62 R67 Y70
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
Biological Process
GO:0007165 signal transduction
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wpl, PDBe:5wpl, PDBj:5wpl
PDBsum5wpl
PubMed29282294
UniProtP01112|RASH_HUMAN GTPase HRas (Gene Name=HRAS)

[Back to BioLiP]