Structure of PDB 5wos Chain A Binding Site BS01

Receptor Information
>5wos Chain A (length=138) Species: 44088 (Canarypox virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKKDEIYYTILNIIQNYFIEYCTGKNRNFHVEDENTYIIVKNMCDIILRD
NIVEFRKDIDRCSDIENEIPEIVYDTIHDKITWGRVISIIAFGAYVTKVF
KEKGRDNVVDLMPDIITESLLSRCRSWLSDQNCWDGLK
Ligand information
>5wos Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEIWIAQELRRIGDEFNAYYA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wos Structural and Functional Insight into Canarypox Virus CNP058 Mediated Regulation of Apoptosis.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
M47 I51 N55 E58 D62 R65 E72 I76 D79 T80 D83 G88 R89 S92 F96
Binding residue
(residue number reindexed from 1)
M43 I47 N51 E54 D58 R61 E68 I72 D75 T76 D79 G84 R85 S88 F92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5wos, PDBe:5wos, PDBj:5wos
PDBsum5wos
PubMed29053589
UniProtQ6VZT9|ARBH_CNPV Apoptosis regulator Bcl-2 homolog (Gene Name=CNPV058)

[Back to BioLiP]