Structure of PDB 5wmq Chain A Binding Site BS01

Receptor Information
>5wmq Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRMEPRAP
WIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYG
CDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAA
RVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wmq Inability To Detect Cross-Reactive Memory T Cells Challenges the Frequency of Heterologous Immunity among Common Viruses.
Resolution1.4 Å
Binding residue
(original residue number in PDB)
Y7 D9 R62 N63 I66 N70 T73 D74 E76 S77 N80 L81 Y84 Y99 N114 Y123 T143 K146 W147 A150 V152 Q155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 D9 R62 N63 I66 N70 T73 D74 E76 S77 N80 L81 Y84 Y99 N114 Y123 T143 K146 W147 A150 V152 Q155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5wmq, PDBe:5wmq, PDBj:5wmq
PDBsum5wmq
PubMed29735483
UniProtP01889|HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain (Gene Name=HLA-B)

[Back to BioLiP]