Structure of PDB 5wle Chain A Binding Site BS01

Receptor Information
>5wle Chain A (length=59) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDDPNKLWCICRQPHNNRFMICCDLCEDWFHGTCVGVTKAMGTDMENKGI
DWKCPKCVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wle A Unique pH-Dependent Recognition of Methylated Histone H3K4 by PPS and DIDO.
Resolution1.952 Å
Binding residue
(original residue number in PDB)		D906 W912 N921 R922 F923 M924 I925 C926 D928 W933 K943 T947 E950
Binding residue
(residue number reindexed from 1)		D2 W8 N17 R18 F19 M20 I21 C22 D24 W29 K39 T43 E46
Enzymatic activity
Enzyme Commision number 3.6.-.-
Gene Ontology
Cellular Component
GO:0048188 Set1C/COMPASS complex

View graph for
Cellular Component
External links
PDB RCSB:5wle, PDBe:5wle, PDBj:5wle
PDBsum5wle
PubMed28919441
UniProtQ9VG78

[Back to BioLiP]