Structure of PDB 5wkt Chain A Binding Site BS01

Receptor Information
>5wkt Chain A (length=326) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIML
GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLH
GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGE
NHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNN
ESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEV
TRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV
YNPVIYIMMNKQFRNCMVTTLCCGKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wkt High-throughput in situ X-ray screening of and data collection from protein crystals at room temperature and under cryogenic conditions.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		L72 R135 A246
Binding residue
(residue number reindexed from 1)		L72 R135 A246
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001965 G-protein alpha-subunit binding
GO:0002046 opsin binding
GO:0004930 G protein-coupled receptor activity
GO:0005085 guanyl-nucleotide exchange factor activity
GO:0005502 11-cis retinal binding
GO:0005515 protein binding
GO:0008020 G protein-coupled photoreceptor activity
GO:0008270 zinc ion binding
GO:0009881 photoreceptor activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:1990763 arrestin family protein binding
Biological Process
GO:0000226 microtubule cytoskeleton organization
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007601 visual perception
GO:0007602 phototransduction
GO:0007603 phototransduction, visible light
GO:0009416 response to light stimulus
GO:0009583 detection of light stimulus
GO:0009642 response to light intensity
GO:0010467 gene expression
GO:0016038 absorption of visible light
GO:0016056 G protein-coupled opsin signaling pathway
GO:0043052 thermotaxis
GO:0045494 photoreceptor cell maintenance
GO:0050953 sensory perception of light stimulus
GO:0050960 detection of temperature stimulus involved in thermoception
GO:0060041 retina development in camera-type eye
GO:0071482 cellular response to light stimulus
GO:0071800 podosome assembly
GO:1904389 rod bipolar cell differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0001750 photoreceptor outer segment
GO:0001917 photoreceptor inner segment
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0016020 membrane
GO:0019867 outer membrane
GO:0042622 photoreceptor outer segment membrane
GO:0042995 cell projection
GO:0060342 photoreceptor inner segment membrane
GO:0097225 sperm midpiece
GO:0097381 photoreceptor disc membrane
GO:0097648 G protein-coupled receptor complex
GO:0120200 rod photoreceptor outer segment
GO:1990913 sperm head plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wkt, PDBe:5wkt, PDBj:5wkt
PDBsum5wkt
PubMed29300389
UniProtP02699|OPSD_BOVIN Rhodopsin (Gene Name=RHO)

[Back to BioLiP]