Structure of PDB 5wje Chain A Binding Site BS01

Receptor Information
>5wje Chain A (length=159) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPFNVVPIHNYPELMKDTCALINAEWPRSETARMRSLEASCDSLPCSLV
LTTEGMCRVIAHLKLSPINSKKKACFVESVVVDKRHRGQGFGKLIMKFAE
DYCRVVLDLKTIYLSTIDQDGFYERIGYEYCAPITMYGPRHCELPSLQNA
KKKYMKKVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wje Structural determinants and cellular environment define processed actin as the sole substrate of the N-terminal acetyltransferase NAA80.
Resolution1.765 Å
Binding residue
(original residue number in PDB)		W36 R38 R43 S46 K73 E87 S88 S124 T125 K161
Binding residue
(residue number reindexed from 1)		W27 R29 R34 S37 K64 E78 S79 S115 T116 K152
Enzymatic activity
Enzyme Commision number 2.3.1.-
Gene Ontology
Molecular Function
GO:0008080 N-acetyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

View graph for
Molecular Function
External links
PDB RCSB:5wje, PDBe:5wje, PDBj:5wje
PDBsum5wje
PubMed29581307
UniProtQ59DX8|NAA80_DROME N-alpha-acetyltransferase 80 (Gene Name=Naa80)

[Back to BioLiP]