Structure of PDB 5wjc Chain A Binding Site BS01

Receptor Information
>5wjc Chain A (length=384) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELNAEIDLQKTIQEEYKLWKQNVPFLYDLVITHALEWPSLTIQWLPDKKT
IPGTDYSIQRLILGTHTSGNDQNYLQIASVQLPNSYTIEISQKIPHDGDV
NRARYMPQKPEIIATMGEGGNAYIFDTTCHDALTTGEALPQAVLKGHTAE
GFGLCWNPNLPGNLATGAEDQVICLWDVQTQSFTSSETKVISPIAKYHRH
TDIVNDVQFHPQHEALLASVSDDCTLQIHDTRLNPEEEAPKVIQAHSKAI
NAVAINPFNDYLLATASADKTVALWDLRNPYQRLHTLEGHEDEVYGLEWS
PHDEPILASSSTDRRVCIWDLEKIGEEQTPEDAEDGSPELLFMHGGHTNR
ISEFSWCPNERWVVGSLADDNILQIWSPSRVIWG
Ligand information
>5wjc Chain B (length=14) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NRVFLRRNVRAVKM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wjc Mis16 Switches Function from a Histone H4 Chaperone to a CENP-ACnp1-Specific Assembly Factor through Eic1 Interaction.
Resolution2.298 Å
Binding residue
(original residue number in PDB)		E29 N36 F39 L40 R349 E365 D366 E368 D369 G370 S371 L374 L375 F376 M377 G379 V415 I416
Binding residue
(residue number reindexed from 1)		E15 N22 F25 L26 R315 E331 D332 E334 D335 G336 S337 L340 L341 F342 M343 G345 V381 I382
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000510 H3-H4 histone complex chaperone activity
GO:0005515 protein binding
GO:0042393 histone binding
Biological Process
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0034080 CENP-A containing chromatin assembly
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0098654 CENP-A recruiting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wjc, PDBe:5wjc, PDBj:5wjc
PDBsum5wjc
PubMed29804820
UniProtO94244|HAT2_SCHPO Histone acetyltransferase type B subunit 2 (Gene Name=mis16)

[Back to BioLiP]