Structure of PDB 5wir Chain A Binding Site BS01

Receptor Information
>5wir Chain A (length=205) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIH
GLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGS
IEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPF
KSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAA
AKVVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wir Dissecting the telomere-inner nuclear membrane interface formed in meiosis.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R102 E106 I109 H110 C126 Q127 T130 R131 L138 D139 A140 Q141 F142 E143 E146 E192
Binding residue
(residue number reindexed from 1)		R42 E46 I49 H50 C66 Q67 T70 R71 L78 D79 A80 Q81 F82 E83 E86 E132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
GO:0042803 protein homodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:5wir, PDBe:5wir, PDBj:5wir
PDBsum5wir
PubMed29083414
UniProtP54274|TERF1_HUMAN Telomeric repeat-binding factor 1 (Gene Name=TERF1)

[Back to BioLiP]