Structure of PDB 5w5u Chain A Binding Site BS01

Receptor Information

>5w5u Chain A (length=322) Species: 211044 (Influenza A virus (A/Puerto Rico/8/1934(H1N1))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLKGIAPL
QLGKCNIAGWLLGNPECDPLLPVRSWSYIVETPNSENGICYPGDFIDYEE
LREQLSSVSSFERFEIFPKESSWPNHNTNGVTAACSHEGKSSFYRNLLWL
TEKEGSYPKLKNSYVNKKGKEVLVLWGIHHPPNSKEQQNLYQNENAYVSV
VTSNYNRRFTPEIAERPKVRDQAGRMNYYWTLLKPGDTIIFEANGNLIAP
MYAFALSRGFGSGIITSNASMHECNTKCQTPLGAINSSLPYQNIHPVTIG
ECPKYVRSAKLRMVTGLRNIPS

Ligand information

>5w5u Chain D (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FPLEYFEWLSA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5w5u Potent peptidic fusion inhibitors of influenza virus.
Resolution	2.461 Å
Binding residue (original residue number in PDB)	H38 V40 T318
Binding residue (residue number reindexed from 1)	H28 V30 T315

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046789	host cell surface receptor binding

	Biological Process
GO:0019064	fusion of virus membrane with host plasma membrane

	Cellular Component
GO:0019031	viral envelope

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5w5u, PDBe:5w5u, PDBj:5w5u
PDBsum	5w5u
PubMed	28971971
UniProt	P03452\|HEMA_I34A1 Hemagglutinin (Gene Name=HA)

[Back to BioLiP]