Structure of PDB 5w5i Chain A Binding Site BS01

Receptor Information

>5w5i Chain A (length=430) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLSVGIHNLLAYVK
HLKGQNEEALKSLKEAENLVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVE
NICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDP
ENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVL
LALKLQDEGQEAEGEKYIEEALANMTYVFRYAAKFYRRKGSVDKALELLK
KALQETPTSVLLHHQIGLCYKAQMIQEKLDKMIRSAIFHFESAVEKKPTF
EVAHLDLARMYIEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQE
FQKKSDVNAIIHYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLES
LSLLGFVYKLEGNMNEALEYYERALRLAAD

Ligand information

>5w5i Chain B (length=4) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaa

....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5w5i Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding
Resolution	2.65 Å
Binding residue (original residue number in PDB)	R38 K151 G154 Y157 R187 G190 F191 A194 Y218 Y252 R255 Y256 K259 R262 L286 H289 Q290 L293 K336 F339 V341 D345 D379
Binding residue (residue number reindexed from 1)	R30 K129 G132 Y135 R165 G168 F169 A172 Y196 Y227 R230 Y231 K234 R237 L261 H264 Q265 L268 K297 F300 V302 D306 D340

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0009615	response to virus
GO:0019060	intracellular transport of viral protein in host cell
GO:0032091	negative regulation of protein binding
GO:0045070	positive regulation of viral genome replication
GO:0045071	negative regulation of viral genome replication
GO:0045087	innate immune response
GO:0051097	negative regulation of helicase activity
GO:0051607	defense response to virus
GO:0051707	response to other organism
GO:0071357	cellular response to type I interferon
GO:0071360	cellular response to exogenous dsRNA
GO:0140374	antiviral innate immune response

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0043657	host cell

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5w5i, PDBe:5w5i, PDBj:5w5i
PDBsum	5w5i
PubMed
UniProt	P09914\|IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 (Gene Name=IFIT1)

[Back to BioLiP]