Structure of PDB 5vx0 Chain A Binding Site BS01

Receptor Information
>5vx0 Chain A (length=169) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMSEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQ
PSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIAT
SLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHS
IARWIAQRGGWVAALNLGN
Ligand information
>5vx0 Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DMRPEIRIAQELRRIGDEFNATYAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vx0 Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.
Resolution1.599 Å
Binding residue
(original residue number in PDB)		R42 I81 I85 N86 Y89 E92 F93 M96 H99 L100 I114 S117 L118 S121 N124 G126 R127 A130 F134 R137 L183 G184
Binding residue
(residue number reindexed from 1)		R26 I65 I69 N70 Y73 E76 F77 M80 H83 L84 I98 S101 L102 S105 N108 G110 R111 A114 F118 R121 L167 G168
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vx0, PDBe:5vx0, PDBj:5vx0
PDBsum5vx0
PubMed29149594
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]