Structure of PDB 5vwy Chain A Binding Site BS01

Receptor Information
>5vwy Chain A (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEQVAQDTEEVFRSYVFYRHQQEQEDPEMVTQPSSTMGQVGRQLAIIGD
DINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLG
FGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGWVAALNL
GNG
Ligand information
>5vwy Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DMRPEIRIAQELRRIGDEFNATYAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vwy Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.
Resolution1.555 Å
Binding residue
(original residue number in PDB)		R42 I81 I85 R88 Y89 E92 F93 M96 I114 S117 L118 S121 N124 G126 R127 A130 G133 F134 R137
Binding residue
(residue number reindexed from 1)		R20 I48 I52 R55 Y56 E59 F60 M63 I81 S84 L85 S88 N91 G93 R94 A97 G100 F101 R104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vwy, PDBe:5vwy, PDBj:5vwy
PDBsum5vwy
PubMed29149594
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]