Structure of PDB 5vwx Chain A Binding Site BS01

Receptor Information
>5vwx Chain A (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSEEQVAQDTEEVFRSYVFYRHQQEQELQPSSTMGQVGRQLAIIGDDINR
RYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYR
LALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGWVAALNLGN
Ligand information
>5vwx Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SRIISRIAQELRRIGDEFNATYA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vwx Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.
Resolution2.489 Å
Binding residue
(original residue number in PDB)		R42 I81 I85 N86 R88 Y89 E92 F93 M96 I114 S117 L118 S121 N124 G126 R127 A130 R137
Binding residue
(residue number reindexed from 1)		R21 I44 I48 N49 R51 Y52 E55 F56 M59 I77 S80 L81 S84 N87 G89 R90 A93 R100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vwx, PDBe:5vwx, PDBj:5vwx
PDBsum5vwx
PubMed29149594
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]