Structure of PDB 5vww Chain A Binding Site BS01

Receptor Information
>5vww Chain A (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSMSEEQVAQDTEEVFRSYVFYRHQQEQEAEPSSTMGQVGRQLAIIGDD
INRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGF
GYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGWVAAL
Ligand information
>5vww Chain C (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MRPEIRIAQELRRIGDEFNATYARR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vww Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.
Resolution2.802 Å
Binding residue
(original residue number in PDB)		Y89 E92 F93 M96 H99 L100 Y110 S117 L118 N124 G126 R127 F134
Binding residue
(residue number reindexed from 1)		Y55 E58 F59 M62 H65 L66 Y76 S83 L84 N90 G92 R93 F100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vww, PDBe:5vww, PDBj:5vww
PDBsum5vww
PubMed29149594
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]