Structure of PDB 5vwv Chain A Binding Site BS01

Receptor Information
>5vwv Chain A (length=170) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMSEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQ
PSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIAT
SLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHS
IARWIAQRGGWVAALNLGNG
Ligand information
>5vwv Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DMRPEIRIAQELRRIGDEFNATYAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vwv Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.
Resolution1.897 Å
Binding residue
(original residue number in PDB)		I81 Y89 E92 F93 M96 H99 L100 K113 I114 S117 L118 N124 G126 R127 A130 F134
Binding residue
(residue number reindexed from 1)		I65 Y73 E76 F77 M80 H83 L84 K97 I98 S101 L102 N108 G110 R111 A114 F118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vwv, PDBe:5vwv, PDBj:5vwv
PDBsum5vwv
PubMed29149594
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]