Structure of PDB 5vwk Chain A Binding Site BS01

Receptor Information
>5vwk Chain A (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRV
SEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWR
ER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vwk Structural basis for the differential interaction of Scribble PDZ domains with the guanine nucleotide exchange factor beta-PIX.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		G737 L738 I740 S741 I742 A743 T749 Y751 S761 H793 V797 L800
Binding residue
(residue number reindexed from 1)		G24 L25 I27 S28 I29 A30 T36 Y38 S48 H80 V84 L87
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5vwk, PDBe:5vwk, PDBj:5vwk
PDBsum5vwk
PubMed29061852
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]