Structure of PDB 5vwi Chain A Binding Site BS01

Receptor Information
>5vwi Chain A (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSVEEIRLPRAGGPLGLSIVGGSDHSSHPFVQEPGVFISKVLPRGLAARS
GLRVGDRILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vwi Structural basis for the differential interaction of Scribble PDZ domains with the guanine nucleotide exchange factor beta-PIX.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		L24 G25 L26 S27 I28 S36 H37 P38 S49 H81
Binding residue
(residue number reindexed from 1)		L15 G16 L17 S18 I19 S27 H28 P29 S39 H71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5vwi, PDBe:5vwi, PDBj:5vwi
PDBsum5vwi
PubMed29061852
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]