Structure of PDB 5vsu Chain A Binding Site BS01

Receptor Information
>5vsu Chain A (length=387) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSKKANEALTRNRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADS
LKKNFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHLTECTLWMTNFP
PSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCV
EKLNGLKIEGYTLVTKVSNPLEKSKRTDSATLEGREIMIRNLSTELLDEN
LLRESFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERALQMNRS
LLGNREISVSLADKKPFLERNEVKRLLASRNSKELETLICLFPLSDKVSP
SLICQFLQEEIHINEKDIRKILLVSDFNGAIIIFRDSKFAAKMLMILNGS
QFQGKVIRSGTINDMKRYYNNQQMSNDDFRKMFLGEL
Ligand information
>5vsu Chain I (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauuugaaacaauacagagaugaucagcgguuccccugcauaaggagaac
cguuuuacaaagagauuuguuuu
..<<<<...................<<<<<<<<.<<.......>>.>>>>
>>>>...>>>>............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vsu Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		N31 T35 R38 W120 T122 N123 R148 S151 R153 F154 S157 R158 R159 F160 Y162 Y186 N194 P195 K198 K200 R201 T202 T206 E211 M213 R215 N216 K239 N241 Q246 F251 N252 N253 F257 R274 S283 D288 K289 K290 F292 L293 R295 N296 K299 R300 R305
Binding residue
(residue number reindexed from 1)		N6 T10 R13 W95 T97 N98 R123 S126 R128 F129 S132 R133 R134 F135 Y137 Y161 N169 P170 K173 K175 R176 T177 T181 E186 M188 R190 N191 K214 N216 Q221 F226 N227 N228 F232 R249 S258 D263 K264 K265 F267 L268 R270 N271 K274 R275 R280
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0017069 snRNA binding
GO:0017070 U6 snRNA binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vsu, PDBe:5vsu, PDBj:5vsu
PDBsum5vsu
PubMed29717126
UniProtP49960|PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 (Gene Name=PRP24)

[Back to BioLiP]