Structure of PDB 5vs7 Chain A Binding Site BS01

Receptor Information
>5vs7 Chain A (length=119) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GYDEIEELKSKNEVLTNLLNKLIAFDKKRIFLYPVNVQLVPDYLNVIKEP
MDFTTMKQKLQNFKYKSFQEFEKDVLLIINNCYTYNDPSTIYYKFAEDIE
TYYKKLNIKIQTKYMNIHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vs7 Bromodomain of PF3D7_1475600 from Plasmodium falciparum complexed with peptide H4K5ac
Resolution2.04 Å
Binding residue
(original residue number in PDB)
D42 Y85 N86 Y92
Binding residue
(residue number reindexed from 1)
D42 Y85 N86 Y92
Enzymatic activity
Enzyme Commision number ?
External links