Structure of PDB 5vnb Chain A Binding Site BS01

Receptor Information
>5vnb Chain A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQF
KLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLL
KLFQSDTNAMLGKKTVVSEFYDEMIFQDP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vnb GAS41 Recognizes Diacetylated Histone H3 through a Bivalent Binding Mode.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		N108 R110
Binding residue
(residue number reindexed from 1)		N90 R92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5vnb, PDBe:5vnb, PDBj:5vnb
PDBsum5vnb
PubMed30071723
UniProtO95619|YETS4_HUMAN YEATS domain-containing protein 4 (Gene Name=YEATS4)

[Back to BioLiP]