Structure of PDB 5vmy Chain A Binding Site BS01

Receptor Information
>5vmy Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQYAYLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vmy CH···O Hydrogen Bonds Mediate Highly Specific Recognition of Methylated CpG Sites by the Zinc Finger Protein Kaiso.
Resolution2.002 Å
Binding residue
(original residue number in PDB)		R501 Y503 V504 C505 S508 R511 E535 Y536 H543 Q563 F564 Y597 A598
Binding residue
(residue number reindexed from 1)		R21 Y23 V24 C25 S28 R31 E55 Y56 H63 Q83 F84 Y117 A118
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5vmy, PDBe:5vmy, PDBj:5vmy
PDBsum5vmy
PubMed29546986
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]