Structure of PDB 5vmw Chain A Binding Site BS01

Receptor Information
>5vmw Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQYAYLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vmw CH···O Hydrogen Bonds Mediate Highly Specific Recognition of Methylated CpG Sites by the Zinc Finger Protein Kaiso.
Resolution2.397 Å
Binding residue
(original residue number in PDB)		R501 Y503 V504 C505 S508 R511 E535 Y536 Q563 Y597 A598
Binding residue
(residue number reindexed from 1)		R21 Y23 V24 C25 S28 R31 E55 Y56 Q83 Y117 A118
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5vmw, PDBe:5vmw, PDBj:5vmw
PDBsum5vmw
PubMed29546986
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]