Structure of PDB 5vmv Chain A Binding Site BS01

Receptor Information
>5vmv Chain A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vmv CH···O Hydrogen Bonds Mediate Highly Specific Recognition of Methylated CpG Sites by the Zinc Finger Protein Kaiso.
Resolution2.313 Å
Binding residue
(original residue number in PDB)
R501 Y503 V504 C505 S508 R511 E535 Q563 R595
Binding residue
(residue number reindexed from 1)
R21 Y23 V24 C25 S28 R31 E55 Q83 R115
Binding affinityPDBbind-CN: Kd=0.43nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5vmv, PDBe:5vmv, PDBj:5vmv
PDBsum5vmv
PubMed29546986
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]