Structure of PDB 5vmu Chain A Binding Site BS01

Receptor Information
>5vmu Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQYAYLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vmu CH···O Hydrogen Bonds Mediate Highly Specific Recognition of Methylated CpG Sites by the Zinc Finger Protein Kaiso.
Resolution2.346 Å
Binding residue
(original residue number in PDB)
Y503 V504 S508 R511 E535 Y536 Q563 F564 Y597 A598
Binding residue
(residue number reindexed from 1)
Y23 V24 S28 R31 E55 Y56 Q83 F84 Y117 A118
Binding affinityPDBbind-CN: Kd=0.2nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5vmu, PDBe:5vmu, PDBj:5vmu
PDBsum5vmu
PubMed29546986
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]