Structure of PDB 5vkl Chain A Binding Site BS01

Receptor Information
>5vkl Chain A (length=202) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THRVINHPYYFPFNGRQAEDYLRSKERGEFVIRQSSRGDDHLVITWKLDK
DLFQHIDIQELEKENPLALGKVLIVDNQKYNDLDQIIVEYLQNKVRLLNE
MTSSEKFKSGTKKDVVKFIEDYSRVNPNKSVYYFSLNHDNPGWFYLMFKI
NANSKLYTWNVKLTNTGYFLVNYNYPSVIQLCNGFKTLLKSNSSKNRMNN
YR
Ligand information
>5vkl Chain B (length=20) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LVNADLDVKDELMFSPLVDS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vkl A novel SH2 recognition mechanism recruits Spt6 to the doubly phosphorylated RNA polymerase II linker at sites of transcription.
Resolution2.198 Å
Binding residue
(original residue number in PDB)		S1379 Y1381 W1392 I1399 N1400 Y1406 W1408 N1409 I1428 N1432 K1435 L1438 K1439 N1445 R1446
Binding residue
(residue number reindexed from 1)		S130 Y132 W143 I150 N151 Y157 W159 N160 I179 N183 K186 L189 K190 N196 R197
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0140673 transcription elongation-coupled chromatin remodeling

View graph for
Biological Process
External links
PDB RCSB:5vkl, PDBe:5vkl, PDBj:5vkl
PDBsum5vkl
PubMed28826505
UniProtP23615|SPT6_YEAST Transcription elongation factor SPT6 (Gene Name=SPT6)

[Back to BioLiP]