Structure of PDB 5vax Chain A Binding Site BS01

Receptor Information
>5vax Chain A (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YDNREIVMKYIHYKLSQRGYEWDTESEVVHLTLRQAGDDFSRRYRRDFAE
MSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNR
EMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMR
Ligand information
>5vax Chain E (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TMENLSRRLKVTGDLFDIMSGQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vax Bcl-2 complex with Beclin 1 pT108 BH3 domain
Resolution2.0 Å
Binding residue
(original residue number in PDB)		A100 F104 R107 Y108 F112 M115 H120 R129 V133 E136 L137 D140 N143 G145 R146 Y202
Binding residue
(residue number reindexed from 1)		A36 F40 R43 Y44 F48 M51 H56 R65 V69 E72 L73 D76 N79 G81 R82 Y138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vax, PDBe:5vax, PDBj:5vax
PDBsum5vax
PubMed
UniProtP10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2)

[Back to BioLiP]