Structure of PDB 5v6x Chain A Binding Site BS01

Receptor Information
>5v6x Chain A (length=84) Species: 192952 (Methanosarcina mazei Go1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNNS
RSSRPARALRYHKYRKTCKRCRVSDEDLNKFLTK
Ligand information
>5v6x Chain C (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaaaccugaucauguagaucgaauggacucuaaauccguucagccgggu
uagauucccgggguuuccgc
<<<<<<<.<<<<.....>>>><<<<<<<.......>>>>>>>..<<<<<.
......>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v6x Crystal structures reveal an elusive functional domain of pyrrolysyl-tRNA synthetase.
Resolution2.76 Å
Binding residue
(original residue number in PDB)		W16 S18 R19 T20 T22 H24 L46 N49 S51 R52 S53 S54 R55 P56 R58 Y62 K64 Y65 R66
Binding residue
(residue number reindexed from 1)		W15 S17 R18 T19 T21 H23 L45 N48 S50 R51 S52 S53 R54 P55 R57 Y61 K63 Y64 R65
Enzymatic activity
Enzyme Commision number 6.1.1.26: pyrrolysine--tRNA(Pyl) ligase.
Gene Ontology
Molecular Function
GO:0004812 aminoacyl-tRNA ligase activity

View graph for
Molecular Function
External links
PDB RCSB:5v6x, PDBe:5v6x, PDBj:5v6x
PDBsum5v6x
PubMed29035363
UniProtQ8PWY1|PYLS_METMA Pyrrolysine--tRNA ligase (Gene Name=pylS)

[Back to BioLiP]