Structure of PDB 5v2q Chain A Binding Site BS01

Receptor Information

>5v2q Chain A (length=298) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AVRREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFE
AKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKFF
KTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITR
VTADISLAKRSVLNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPA
QLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQC
PPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSSNLPNPLLSRT

Ligand information

>5v2q Chain B (length=19) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ASPLEEDLCGYLCWITQAE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5v2q Stapled Voltage-Gated Calcium Channel (CaV) alpha-Interaction Domain (AID) Peptides Act As Selective Protein-Protein Interaction Inhibitors of CaV Function.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	M295 M296 K298 V399 L403 S406 E440 N441 L443 A446
Binding residue (residue number reindexed from 1)	M129 M130 K132 V221 L225 S228 E262 N263 L265 A268

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005245	voltage-gated calcium channel activity

	Biological Process
GO:0070588	calcium ion transmembrane transport

	Cellular Component
GO:0005891	voltage-gated calcium channel complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5v2q, PDBe:5v2q, PDBj:5v2q
PDBsum	5v2q
PubMed	28278376
UniProt	Q8VGC3\|CACB2_RAT Voltage-dependent L-type calcium channel subunit beta-2 (Gene Name=Cacnb2)

[Back to BioLiP]