Structure of PDB 5v1z Chain A Binding Site BS01

Receptor Information
>5v1z Chain A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNV
EDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEE
HCRKVNEYLNNP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v1z Structure and energetics of pairwise interactions between proteasome subunits RPN2, RPN13, and ubiquitin clarify a substrate recruitment mechanism.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R27 M31 T36 T37 V38 P40 R64 Q87 C88 V93 F106 W108 Q110
Binding residue
(residue number reindexed from 1)		R8 M12 T17 T18 V19 P21 R45 Q68 C69 V74 F87 W89 Q91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:5v1z, PDBe:5v1z, PDBj:5v1z
PDBsum5v1z
PubMed28442575
UniProtQ16186|ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 (Gene Name=ADRM1)

[Back to BioLiP]