Structure of PDB 5v1y Chain A Binding Site BS01

Receptor Information
>5v1y Chain A (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSG
NVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQD
EEHCRKVNEYLNNP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v1y Structure and energetics of pairwise interactions between proteasome subunits RPN2, RPN13, and ubiquitin clarify a substrate recruitment mechanism.
Resolution1.421 Å
Binding residue
(original residue number in PDB)		R27 M31 T36 T37 V38 R64 C88 S90 R104 F106 W108 Q110 P112
Binding residue
(residue number reindexed from 1)		R10 M14 T19 T20 V21 R47 C71 S73 R87 F89 W91 Q93 P95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:5v1y, PDBe:5v1y, PDBj:5v1y
PDBsum5v1y
PubMed28442575
UniProtQ16186|ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 (Gene Name=ADRM1)

[Back to BioLiP]