Structure of PDB 5v1d Chain A Binding Site BS01

Receptor Information
>5v1d Chain A (length=193) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSLVIISTLDGRIAALDPENHGKKQWDLDVGSGSLVSSMIIPSLDGDLFQ
ETVPFTVESLLEDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYITVIKVSVADWKVMAFNKKGGH
LEWEYQFSTPIASAWLVKDGKVIPISLFDYLGMYRGQLYLQSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v1d The luminal domain of the ER stress sensor protein PERK binds misfolded proteins and thereby triggers PERK oligomerization
Resolution2.799 Å
Binding residue
(original residue number in PDB)		W318 D358 Y388 L389 G390 M391 S401
Binding residue
(residue number reindexed from 1)		W139 D179 Y180 L181 G182 M183 S193
Enzymatic activity
Enzyme Commision number ?
External links